PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00040.1.g02110.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 513aa    MW: 54868 Da    PI: 6.19
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00040.1.g02110.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.71.7e-07201239543
                                   SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHH CS
                      Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterq 43 
                                   +++t++q ++Le++F  + +p++++r+eL +  gL+e+q
  Zjn_sc00040.1.g02110.1.sm.mk 201 QRLTSQQSQILESFFSTCAHPTEAQRKELVETAGLSENQ 239
                                   5789*********************************98 PP

2START68.42e-2235646196206
                                   EXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SS CS
                         START  96 aelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgr 175
                                    e++++sp+vp R+ +f+R++ +l++g  +ivd+Svd  +       ++++++  Sgili+p   + +kvt++ehv l++ 
  Zjn_sc00040.1.g02110.1.sm.mk 356 VEMVFPSPVVPaRKCTFLRHCTTLEDGATAIVDISVDDGEGT-----FIKCHKMASGILIQPIRSNTCKVTVIEHVRLEDT 431
                                   689**********************************99883.....8********************************* PP

                                   XXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                         START 176 lphwllrslvksglaegaktwvatlqrqcek 206
                                    +h l+r+ + sgl +ga++ v  + rqc++
  Zjn_sc00040.1.g02110.1.sm.mk 432 GIHDLFRPCL-SGLLFGARRLVMSMARQCAR 461
                                   ********98.699**************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5148525.669171IPR003245Phytocyanin domain
PfamPF022984.6E-10562IPR003245Phytocyanin domain
Gene3DG3DSA:2.60.40.4203.4E-19574IPR008972Cupredoxin
SuperFamilySSF495034.31E-18570IPR008972Cupredoxin
ProDomPD0031229.0E-26569IPR003245Phytocyanin domain
Gene3DG3DSA:1.10.10.603.2E-9184239IPR009057Homeodomain-like
SuperFamilySSF466891.92E-7190240IPR009057Homeodomain-like
SMARTSM003890.0073196252IPR001356Homeobox domain
PfamPF000464.0E-5201239IPR001356Homeobox domain
CDDcd000861.20E-6201239No hitNo description
PROSITE profilePS5084814.606270452IPR002913START domain
SuperFamilySSF559611.51E-13278429No hitNo description
SMARTSM002343.8E-9279461IPR002913START domain
PfamPF018528.3E-18356461IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
GO:0009055Molecular Functionelectron carrier activity
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MAKPFTYQAG NDSVLLVDQR SYDACDTSSP IDTFSDGSTV FTFTRSSPYY FISGSKDNCN  60
RGEKLIVVVM AERSTVDNGT QPITGMAPAP NGPFSPFSPP PPPFGIDISP AANPPPPNAA  120
SCKVAGGAGA VALAIGAMFY ALCEASERSP SDPEIVHATN AAAALGITEV DSRSSINNRN  180
IHEGAHGSGQ NGPQAKKNIH QRLTSQQSQI LESFFSTCAH PTEAQRKELV ETAGLSENQL  240
TRLKSELPIN LPALNRGFPL ETSSENEFVR IDDARVLAGI AKNAVHEFVT MANSDGPMWM  300
SVPGGSLETL NMMAYLYAFP GQSSAIGLQM EANRANAVVM LGSKSVVEFL MDDVTVEMVF  360
PSPVVPARKC TFLRHCTTLE DGATAIVDIS VDDGEGTFIK CHKMASGILI QPIRSNTCKV  420
TVIEHVRLED TGIHDLFRPC LSGLLFGARR LVMSMARQCA RIRDVFHVAN SSTSGNTVNL  480
QCPTATSNTH NHTLTGPESP ALFQSARKEG RSS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660716.17e-84PREDICTED: homeobox-leucine zipper protein TF1
TrEMBLK3XF218e-84K3XF21_SETIT; Uncharacterized protein
STRINGSi000488m2e-83(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104752833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.12e-31protodermal factor 2